2.20 Rating by ClearWebStats
trichypropertybazaar.com is 1 decade 1 year 10 months old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, trichypropertybazaar.com is SAFE to browse.
Get Custom Widget

Traffic Report of Trichypropertybazaar

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
View trichypropertybazaar.com site advisor rating Not Applicable

Where is trichypropertybazaar.com server located?

Hosted IP Address:

162.241.148.33 View other site hosted with trichypropertybazaar.com

Hosted Country:

trichypropertybazaar.com hosted country US trichypropertybazaar.com hosted country

Location Latitude:

40.2342

Location Longitude:

-111.6442

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View trichypropertybazaar.com HTML resources

Homepage Links Analysis

Trichy Propertybazaar
trichypropertybazaar.com has many categories like House and Apartments are listed or advertised and allows searching, buying, rent or taking on lease. Property owners post their properties for sale or rent; developers and builders advertise their projects, to global visitors, real estate consultants and brokers list properties to expand their market place.

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 1
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 1 Total Images: 20
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 162.241.148.33)

Home - Jennifer Chem Sales

trichypropertybazaar.com favicon - jenniferchemsales.com

View trichypropertybazaar.com Pagerank   trichypropertybazaar.com alexa rank Not Applicable   trichypropertybazaar.com website value $ 8.95

Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute

trichypropertybazaar.com favicon - shrivishwakarmasafetytraininginstitute.com

View trichypropertybazaar.com Pagerank   trichypropertybazaar.com alexa rank Not Applicable   trichypropertybazaar.com website value $ 8.95

The Shine English Academy – DREAM | LEARN | SPEAK

trichypropertybazaar.com favicon - theshineenglishacademy.com

View trichypropertybazaar.com Pagerank   trichypropertybazaar.com alexa rank Not Applicable   trichypropertybazaar.com website value $ 8.95

Urvashi International Packers and Movers|Movers and Packers Hyderabad

trichypropertybazaar.com favicon - urvashiinternationalpackers.com

Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers

View trichypropertybazaar.com Pagerank   trichypropertybazaar.com alexa rank Not Applicable   trichypropertybazaar.com website value $ 8.95

247 Best Pill Pharma – Order Prescription Drugs in our Online shop

trichypropertybazaar.com favicon - 247bestpillpharma.com

View trichypropertybazaar.com Pagerank   trichypropertybazaar.com alexa rank Not Applicable   trichypropertybazaar.com website value $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sun, 21 Jul 2019 14:53:22 GMT
Server: Apache/2.4.39 (cPanel) OpenSSL/1.0.2r mod_bwlimited/1.4 Phusion_Passenger/5.3.7
X-Powered-By: PHP/7.3.3
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Upgrade: h2,h2c
Connection: Upgrade
Accept-Ranges: none
Vary: Accept-Encoding
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Domain Information for trichypropertybazaar.com

Domain Registrar: CRAZY DOMAINS FZ-LLC trichypropertybazaar.com registrar info
Registration Date: 2012-06-17 1 decade 1 year 10 months ago
Last Modified: 2019-07-18 4 years 9 months 4 weeks ago

Domain Nameserver Information

Host IP Address Country
ns801.globehost.org trichypropertybazaar.com name server information 162.241.148.33 trichypropertybazaar.com server is located in United States United States
ns802.globehost.org trichypropertybazaar.com name server information 162.241.148.33 trichypropertybazaar.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
trichypropertybazaar.com A 14399 IP:162.241.148.33
trichypropertybazaar.com NS 21599 Target:ns1.bh-ht-17.webhostbox.net
trichypropertybazaar.com NS 21599 Target:ns2.bh-ht-17.webhostbox.net
trichypropertybazaar.com SOA 21599 MNAME:ns1.bh-ht-17.webhostbox.net
RNAME:cpanel.webhostbox.net
Serial:2019050802
Refresh:3600
Retry:1800
Expire:1209600
trichypropertybazaar.com MX 14399 Target:trichypropertybazaar.com
trichypropertybazaar.com TXT 14399 TXT:v=spf1 +a +mx +ip4:162.241.148.33 ~all

Similarly Ranked Websites to Trichypropertybazaar

Google

trichypropertybazaar.com favicon - google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

View trichypropertybazaar.com Pagerank   Alexa rank for trichypropertybazaar.com 1   website value of trichypropertybazaar.com $ 8,833,062,960.00

Google Calendar - Sign in to Access & Edit Your Schedule

trichypropertybazaar.com favicon - calendar.google.com

Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).

View trichypropertybazaar.com Pagerank   Alexa rank for trichypropertybazaar.com 1   website value of trichypropertybazaar.com $ 8,833,062,960.00

Gmail

trichypropertybazaar.com favicon - mail.google.com

Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

View trichypropertybazaar.com Pagerank   Alexa rank for trichypropertybazaar.com 1   website value of trichypropertybazaar.com $ 8,833,062,960.00

Android Apps on Google Play

trichypropertybazaar.com favicon - play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

View trichypropertybazaar.com Pagerank   Alexa rank for trichypropertybazaar.com 1   website value of trichypropertybazaar.com $ 8,833,062,960.00

Google Chrome - Download the Fast, Secure Browser from Google

trichypropertybazaar.com favicon - chrome.google.com

Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.

View trichypropertybazaar.com Pagerank   Alexa rank for trichypropertybazaar.com 1   website value of trichypropertybazaar.com $ 8,833,062,960.00

Full WHOIS Lookup for trichypropertybazaar.com

Domain Name: TRICHYPROPERTYBAZAAR.COM
Registry Domain ID: 1727831413_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.crazydomains.com
Registrar URL: http://www.crazydomains.com
Updated Date: 2019-07-18T08:18:31Z
Creation Date: 2012-06-17T16:37:27Z
Registry Expiry Date: 2020-06-17T16:37:27Z
Registrar: Crazy Domains FZ-LLC
Registrar IANA ID: 1291
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +61 894 220 890
Domain Status: ok https://icann.org/epp#ok
Name Server: NS801.GLOBEHOST.ORG
Name Server: NS802.GLOBEHOST.ORG
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-07-21T14:53:05Z